PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Rsa1.0_00104.1_g00048.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Raphanus
Family MYB
Protein Properties Length: 279aa    MW: 31515.2 Da    PI: 5.1018
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Rsa1.0_00104.1_g00048.1genomeRGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.78.6e-161461148
                             TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                             +g WT+eEd  lv ++ ++G g W+t +++ g+ R++k+c++rw++yl
  Rsa1.0_00104.1_g00048.1 14 KGEWTAEEDRMLVVYISEHGLGEWRTLPKRAGLQRCGKSCRLRWLNYL 61
                             799*******************************************97 PP

2Myb_DNA-binding56.94.8e-1867111147
                              TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
          Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                              rg++T++E+e +++ + +lG++ W++Ia+ m+ +Rt++++k++w++ 
  Rsa1.0_00104.1_g00048.1  67 RGKFTPQEEEDIIKFHSLLGNR-WAAIAKQMP-NRTDNDIKNHWNSC 111
                              89********************.*********.***********975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.097961IPR017930Myb domain
SuperFamilySSF466891.47E-2911108IPR009057Homeodomain-like
SMARTSM007173.9E-121363IPR001005SANT/Myb domain
PfamPF002495.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.4E-221568IPR009057Homeodomain-like
CDDcd001671.82E-91661No hitNo description
PROSITE profilePS5129426.03162116IPR017930Myb domain
SMARTSM007176.0E-1666114IPR001005SANT/Myb domain
PfamPF002491.0E-1667111IPR001005SANT/Myb domain
CDDcd001671.74E-1069109No hitNo description
Gene3DG3DSA:1.10.10.602.3E-2569116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 279 aa     Download sequence    Send to blast
MGRTTWFDDD GLKKGEWTAE EDRMLVVYIS EHGLGEWRTL PKRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TPQEEEDIIK FHSLLGNRWA AIAKQMPNRT DNDIKNHWNS CLKKRLARSG  120
IDPTTHKPTV TVAKATSSST TSSPTPTPSS SSSTSSSFSS TGSARLLNKL ATGISSRKHE  180
LDRIKNVIMS EPRQAVEEDE MMISSKEDEE EVIGCSMEID GNLISTTSFD EYLTCDFTPP  240
DTTGFVSAFD DYSLVEPYDL YQSDFYHETT DDQLDLFLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A6e-27121165108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankKF7382850.0KF738285.1 Brassica napus MYB transcription factor 95 (MYB95.1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013649727.11e-172PREDICTED: myb-related protein 308-like
SwissprotO643994e-60MYB34_ARATH; Transcription factor MYB34
TrEMBLA0A078C7P61e-172A0A078C7P6_BRANA; BnaC06g35340D protein
STRINGBra015911.1-P1e-170(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.11e-121myb domain protein 95